PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.D00810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family B3
Protein Properties Length: 373aa    MW: 40587.7 Da    PI: 10.042
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.D00810.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B333.29.1e-11221121398
                     TT-EE--HHH.HTT........---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  13 sgrlvlpkkfaeeh........ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     ++ l++p +fa++         g        + l ++ g++W+  l+  +++g+  l+ GW +F+ a+g+++g +vv++ ++  ++  +v++f+
  Pahal.D00810.1  22 LHELRVPGEFAARLgseegatgG-GDGAAAVVLLVSPLGKVWRAGLRRAGGGGAWQLGVGWAGFAAAHGVEAGWSVVLRSER--RGVATVRAFD 112
                     567999****9999877777743.334667899999**********8888888899***********************544..4545888776 PP

2B344.82.2e-141171941797
                     E--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3  17 vlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     ++p kf++eh   + ++s+  ++ ++ g+ W ++l  ++++++++l++GW +F  a++  eg ++vF++++++ f  +v +f
  Pahal.D00810.1 117 RIPDKFVQEHlTDNYPSSQNAMIFSPLGKFWHIEL--DRHQSGMLLGDGWARFLTAHDFSEGNILVFRYQNNMVF--TVEAF 194
                     79*********555568889***************..********************************998998..66665 PP

3B341.62.1e-132903691396
                     TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     s ++ + k+ +++ g+  ++++tl++   + rsW v +++ ++  +y+ + GWk+F+++n+LkegD ++F++++++ +  +v++
  Pahal.D00810.1 290 S-LFAVKKSICSSVGLLGTCEITLKMSMGNTRSWPVWFKMANTY-GYITGPGWKRFCRENKLKEGDRCTFSVIKTTVR--YVTI 369
                     3.47888999999998889999999999999*******765554.69999*********************9886555..5555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508636.8651099IPR003340B3 DNA binding domain
SMARTSM010190.001113114IPR003340B3 DNA binding domain
SuperFamilySSF1019362.75E-1115113IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.5E-1123113IPR015300DNA-binding pseudobarrel domain
PfamPF023624.6E-823113IPR003340B3 DNA binding domain
PROSITE profilePS5086311.984101197IPR003340B3 DNA binding domain
SMARTSM010190.022115197IPR003340B3 DNA binding domain
PfamPF023622.2E-11116194IPR003340B3 DNA binding domain
CDDcd100172.67E-10117194No hitNo description
Gene3DG3DSA:2.40.330.101.3E-15117199IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-15117199IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-17273370IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.0E-17274370IPR015300DNA-binding pseudobarrel domain
CDDcd100174.39E-11277367No hitNo description
SMARTSM010191.8E-6279372IPR003340B3 DNA binding domain
PfamPF023622.3E-10292365IPR003340B3 DNA binding domain
PROSITE profilePS5086311.364309372IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MAPVVHRARL KYAAAPLSPA CLHELRVPGE FAARLGSEEG ATGGGDGAAA VVLLVSPLGK  60
VWRAGLRRAG GGGAWQLGVG WAGFAAAHGV EAGWSVVLRS ERRGVATVRA FDAAGARIPD  120
KFVQEHLTDN YPSSQNAMIF SPLGKFWHIE LDRHQSGMLL GDGWARFLTA HDFSEGNILV  180
FRYQNNMVFT VEAFTQNGCL MEHEAAAADM TEDATGPSIV PQQGVLKELV VSPVKKKRKS  240
RNENTCLEVY REKPNLPPIS SKKVASQKKL VSSVPHHSFT KQITGYDLTS LFAVKKSICS  300
SVGLLGTCEI TLKMSMGNTR SWPVWFKMAN TYGYITGPGW KRFCRENKLK EGDRCTFSVI  360
KTTVRYVTIV SS*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700752.11e-131PREDICTED: putative B3 domain-containing protein Os06g0632500
SwissprotQ67VL71e-119Y6325_ORYSJ; Putative B3 domain-containing protein Os06g0632500
TrEMBLK3Y2K31e-160K3Y2K3_SETIT; Uncharacterized protein
STRINGSi008427m1e-159(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31640.16e-13B3 family protein